PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI06G21070.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 513aa    MW: 56710.5 Da    PI: 4.6133
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI06G21070.2genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding591.1e-1880127148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT++Ed++l ++v+ +G g+W+++ r  g++R++k+c++rw ++l
  OMERI06G21070.2  80 KGPWTPDEDKRLREYVEAHGEGNWNRVQRNAGLNRCGKSCRLRWANHL 127
                      79******************************************9986 PP

2Myb_DNA-binding42.21.9e-13133176146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++++eE+e +++++  lG++ W++ a+ ++ gRt++++k++w++
  OMERI06G21070.2 133 KGPFSKEEEEMIIKLHLWLGNK-WAKMANSLP-GRTDNEIKNFWNT 176
                      79********************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.63975131IPR017930Myb domain
SuperFamilySSF466892.77E-3077174IPR009057Homeodomain-like
SMARTSM007175.2E-1679129IPR001005SANT/Myb domain
PfamPF002494.4E-1780127IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-2481134IPR009057Homeodomain-like
CDDcd001674.62E-1282127No hitNo description
SMARTSM007171.9E-12132180IPR001005SANT/Myb domain
PROSITE profilePS5129416.24132182IPR017930Myb domain
PfamPF002494.0E-12133176IPR001005SANT/Myb domain
CDDcd001671.32E-9135176No hitNo description
Gene3DG3DSA:1.10.10.608.6E-24135180IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 513 aa     Download sequence    Send to blast
MRMEGSSPME EDEPAAMLAG SQGESPAMLY PSGDGDRDGD DDEGDASGGE EEQGGVARAG  60
VRRRGGGVRV RVRGRIPLKK GPWTPDEDKR LREYVEAHGE GNWNRVQRNA GLNRCGKSCR  120
LRWANHLKPD LKKGPFSKEE EEMIIKLHLW LGNKWAKMAN SLPGRTDNEI KNFWNTRCKR  180
IQRTGEPLYP KEFNHFKLTD LEVMNCESPD ESRAKKRTNE VLQGNGQSYK EVFFDNLDYS  240
RPENYIRPNC VTPNSLPVDA TSPFGSAIAT QDQSVPFGSA IVSGHPILDG NFSTSGTIQR  300
PMNVELPSLQ YPNYDFNNNN AWSYHDPLGH PIDQVDFGSL RSEYLSPNNN GLLDALVHGG  360
HGQGELANSQ GSFDACFPRV QCNQVIQSNA FSLSSSFPII GDDLLENSCH AFVGINNNAS  420
SLFLDSQPPP LVDPTFWRHD VSLEPNLPVY CQFNEELPPS NEQFAKDADD AFGHGGLSDE  480
TNLAAAGQGD EHDLENPWAS MPGACDIPDF PSE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-28781805106B-MYB
1h8a_C1e-277818025126MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2120750.0AB212075.1 Oryza sativa Japonica Group mRNA for GAMYB-like1, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015641123.10.0PREDICTED: transcription factor GAMYB
TrEMBLA0A0E0E3P60.0A0A0E0E3P6_9ORYZ; Uncharacterized protein
STRINGORGLA06G0168900.10.0(Oryza glaberrima)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G32460.21e-55myb domain protein 101